Zum Inhalt springen

Custom Mouse anti-Human TRDV3 Monoclonal Antibody, FITC Conjugated - 5 mg

https://www.gentaur.be/web/image/product.template/17740/image_1920?unique=325b45d
(0 Rezension)

Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * FITC conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks

0,00 € 0.0 EUR 0,00 € Exklusive Steuern

info@gentaur.com

    Diese Kombination existiert nicht.

    Geschäftsbedingungen
    30 Tage Geld-zurück-Garantie
    Versand: 2-3 Geschäftstage